PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.5299s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 264aa    MW: 29451.6 Da    PI: 5.6521
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.5299s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC53.36e-176861898
                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         ++++P +rikki+++de+v +i+  +P l+ska elf+ +l   ++  +     +t++   ++++v   +ifdfl ++v +
  Araha.5299s0002.1.p  6 QTRFPATRIKKIMQTDEEVGKIAMAVPLLVSKALELFLQDLCNHTYDVTLRRGAKTVNSFHLKQCVHAFNIFDFLRETVGK 86
                         789************************************************************************999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.8E-25272IPR009072Histone-fold
PfamPF008082.2E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.1E-181887IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MKKKLQTRFP ATRIKKIMQT DEEVGKIAMA VPLLVSKALE LFLQDLCNHT YDVTLRRGAK  60
TVNSFHLKQC VHAFNIFDFL RETVGKVPDL GGSDAEDQSA TKRRKLVDES SYNDEDTTKT  120
TQMHEVKHTS GGRGRRGRGH GRGGGRTGSG LSLKFEEDLK DGSPGSSRTP SPEIRSLSHD  180
YTSWKKVASL NNHSNSVVKV RNFDLNVELD ENGDSATWLD RALEGSPDWP LLEINEMKID  240
PDQQQASSAN DEEDYDEESI DQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-23271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132142RGRRGRGHGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026881e-131CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankT20D11e-131AF296830.1 Arabidopsis thaliana BAC T20D1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197450.21e-141Histone superfamily protein
TrEMBLF4K1621e-141F4K162_ARATH; Histone superfamily protein
STRINGAT5G19490.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139682124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.11e-140NF-YC family protein